Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

SKU: orb1692665

Description

This synthetic peptide, NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, is derived from the ACE2 receptor and serves as a key research tool. It is utilized in both in vitro and in vivo studies to investigate ACE2-related mechanisms, including viral entry and cardiovascular functions, across virology and cell signaling research fields.

Research Area

Metabolism Research

Images & Validation

Key Properties

TargetAngiotensin-converting Enzyme (ACE)

Storage & Handling

Storage-20°C
Expiration Date12 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide