NSF Rabbit Polyclonal Antibody

SKU: orb577703

Description

Rabbit polyclonal antibody to NSF

Research Area

Epigenetics

Images & Validation

−

Item 1 of 3

Tested Applications	IHC, WB
Reactivity	Human, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human NSF
Target	NSF
Protein Sequence	Synthetic peptide located within the following region: STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL
Molecular Weight	83kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

SKD2, SEC18

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Type: 1. NT-2 cells, 2. mouse brain extracts, Primary Antibody Dilution: 2 ug/ml, Secondary Antibody Dilution: 1:20000, Secondary Antibody: IRDye 800CW goat anti-rabbit, Lane 1: 60 ug/lane, Lane 2: 80 ug/lane.

Sample Type: Mouse brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: NSF: Red DAPI:Blue, Gene Name: NSF.

WB Suggested Anti-NSF Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Quick Database Links

Gene Symbol

NSF

UniProt

P46459

RefSeq:XP_001128468

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

RefSeq	XP_001128468

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols