NSP3 (SARS-CoV-2) Antibody

SKU: orb1463325

Description

Nsp3 is part of the multifunctional protein replicase polyprotein 1ab that is involved in the transcription and replication of viral RNA. This non-structural protein has been implicated on several mechanisms such as the cleavage located at the N-terminus of the replicase polyprotein and rearrangement of host membrane that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication.

Images & Validation

−

Tested Applications	WB
Dilution range	WB:1:500-1:2,000
Reactivity	Virus
Application Notes	The antibody solution should be gently mixed before use.

Key Properties

−

Antibody Type	Primary Antibody
Host	Goat
Clonality	Polyclonal
Isotype	IgG
Immunogen	Antigen: Affinity purified recombinant fusion protein using the C-terminal of Nsp3 (residues 1846 to stop) and produced in E. coli.. Antigen Sequence: MEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG
Target	NSP3 (SARS-CoV-2)
Purification	Epitope affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	PBS, 20% glycerol and 0.05% sodium azide
Concentration	1 mg/ml
Disclaimer	For research use only

Alternative Names

−

Nsp3 SARS Coronavirus-2 antibody.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

NSP3 (SARS-CoV-2)

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols