ORF3a (SARS-CoV-2) Antibody

SKU: orb1463331

Description

ORF3a encodes a viral accessory and uncharacterised protein with possible role in the viral life cycle. Six functional domains have been identified and have linked to infectivity, virulence, ion channel formation and virus release.

Images & Validation

−

Tested Applications	WB
Dilution range	WB:1:500-1:2,000
Reactivity	Virus
Application Notes	The antibody solution should be gently mixed before use.

Key Properties

−

Antibody Type	Primary Antibody
Host	Goat
Clonality	Polyclonal
Isotype	IgG
Immunogen	Antigen: Affinity purified fusion recombinant protein using the C-terminal of ORF3a (residues 160 to stop) and produced in E. coli.. Antigen Sequence: MNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
Target	ORF3a (SARS-CoV-2)
Purification	Epitope affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	PBS, 20% glycerol and 0.05% sodium azide
Concentration	1 mg/ml
Disclaimer	For research use only

Alternative Names

−

ORF3a SARS Coronavirus-2 antibody.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

ORF3a (SARS-CoV-2)

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols