Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ORF3a (SARS-CoV-2) Antibody

SKU: orb1463331

Description

ORF3a encodes a viral accessory and uncharacterised protein with possible role in the viral life cycle. Six functional domains have been identified and have linked to infectivity, virulence, ion channel formation and virus release.

Research Area

Infectious Disease & Virology

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:500-1:2,000
ReactivityVirus
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Affinity purified fusion recombinant protein using the C-terminal of ORF3a (residues 160 to stop) and produced in E. coli. Antigen Sequence: MNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
TargetORF3a (SARS-CoV-2)
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ORF3a SARS Coronavirus-2 antibody.

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μg
$ 300.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry