You have no items in your shopping cart.
Oxyntomodulin
SKU: orb1147065
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 4421.86 Da |
|---|---|
| Protein Sequence | H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH |
| Purity | > 95% by HPLC |
Storage & Handling
−| Storage | Store dry, dark and frozen |
|---|---|
| Form/Appearance | Freeze dried solid |
| Disclaimer | For research use only |
Alternative Names
−feeding, 62340-29-8GH070, GLP-1), Glucagon 37, HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, OXM, Oxyntomodulin , anorectic, endogenous, glucagon-like peptide, metabolism
Similar Products
−- Item 1 of 12
GLP-1 (1G9) Mouse Monoclonal Antibody [orb10721]
IF, IHC-Fr, IHC-P
Mouse, Rat
Human, Mouse, Rat
Mouse
Monoclonal
Unconjugated
200 μl, 50 μl, 100 μl, 200 μg - Item 1 of 7
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Oxyntomodulin (orb1147065)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days