Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PER2 Rabbit Polyclonal Antibody

SKU: orb577174

Description

Rabbit polyclonal antibody to PER2

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityEquine, Mouse, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PER2
TargetPER2
Protein SequenceSynthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ
Molecular Weight137 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

FASPS, FASPS1

Similar Products

  • Per2 (phospho Ser662) rabbit pAb Antibody [orb770771]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Per2 rabbit pAb Antibody [orb770772]

    ELISA,  IF,  IHC

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • PER2 Rabbit Polyclonal Antibody [orb500690]

    IF,  IHC-Fr,  IHC-P

    Human

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PER2 Rabbit Polyclonal Antibody [orb629813]

    ELISA,  IP,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • PER2 Rabbit Polyclonal Antibody [orb2954041]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

PER2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 137 kDa, 98 kDa and 80 kDa. The protein may be modified by phosphorylation and/or acetylation.

PER2 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 2 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. 721_B, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in 721_B.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. Adult Placenta, Antibody Dilution: 1.0 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. Fetal Heart, Antibody Dilution: 1.0 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. Fetal Lung, Antibody Dilution: 1.0 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. MCF7, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in MCF7.

PER2 Rabbit Polyclonal Antibody

Sample Type: Human Hela, Antibody Dilution: 1.0 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in Jurkat.

PER2 Rabbit Polyclonal Antibody

WB Suggested Anti-PER2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_073728

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PER2 Rabbit Polyclonal Antibody (orb577174)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry