PSMA2 Rabbit Polyclonal Antibody

SKU: orb583168

Description

Rabbit polyclonal antibody to PSMA2

Research Area

Protein Biochemistry

Images & Validation

−

Item 1 of 12

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA2
Target	PSMA2
Protein Sequence	Synthetic peptide located within the following region: VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV
Molecular Weight	26kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

MU, HC3, PSC2, PMSA2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in HEK293T.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PSMA2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. PSMA2 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in Jurkat.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in MCF7.

WB Suggested Anti-PSMA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

PSMA2

UniProt

P25787

RefSeq (Protein):NP_002778

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_002778

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols