You have no items in your shopping cart.
Rab25 Antibody
SKU: orb11633
Description
Images & Validation
−Item 1 of 2
| Tested Applications | IF, IHC-Fr, IHC-P, WB |
|---|---|
| Dilution Range | WB:1:250-1:2,000, IF:1:25-1:250, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000 |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Application Notes |
Key Properties
−| Host | Goat |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab25 produced in E. coli. Antigen Sequence: MIVVMLVGNKSDLSQAREVPTEEACMFAENNGLLFLETSALDSTNVELAFQTVLKEIFAKVSKQKQNSTRTSAITLGNAQAGQDPGPGEKRACCISL |
| Target | RAB25, member RAS oncogene family |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. |
| Concentration | Please inquire |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CATX-8, RAB11C antibody.
Similar Products
−- Item 1 of 4
- Item 1 of 3
- Item 1 of 2
- Item 1 of 2
- Item 1 of 2
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Western blot analysis of transfected 293HEK cell lysate using Rab25 antibody
Immunofluorescence analysis of Hepa1-6 cells using Rab25 antibody at 1:50 dilution.
Quick Database Links
Gene Symbol
RAB25, member RAS oncogene family
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC-P
Immunohistochemistry Paraffin
IHC-Fr
Immunohistochemistry Frozen
IF
Immunofluorescence
Rab25 Antibody (orb11633)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 2-3 days