Rat APRIL protein

SKU: orb1216247

Description

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 287437).

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Rat
Target	APRIL
Molecular Weight	16.4 kDa
Protein Length	146.0
Protein Sequence	AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)
Purity	98%

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

TNFSF13

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

APRIL

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols