RCBTB2 Rabbit Polyclonal Antibody

SKU: orb327434

Description

RCBTB2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RCBTB2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human RCBTB2. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Human

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human RCBTB2
Target	RCBTB2
Protein Sequence	Synthetic peptide located within the following region: NSYGQLGTGNKSNQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYM
Molecular Weight	60 kDa
Purification	Affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti RLG antibody, anti CHC1L antibody, anti antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

RCBTB2

UniProt

O95199

RefSeq (Protein):NP_001259.1

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001259.1

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Applications:	FC, IHC-P, WB
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, WB
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	WB
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	WB
Predicted Reactivity:	Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
Reactivity:	Mouse
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, WB
Predicted Reactivity:	Mouse, Rat
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated