You have no items in your shopping cart.
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-Myc-tagged |
| Expression Region | 27-248aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test |
| MW | 32.6 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Cationic antimicrobial protein CAP371 Publication (Heparin-binding protein1 Publication) (HBP1 Publication) (hHBP1 Publication)
Similar Products
−Recombinant human Azurocidin, His (HEK293) [orb1516654]
>95% as determined by SDS-PAGE
40 kDa
100 μg, 500 μg, 20 μgRecombinant Human Azurocidin Protein [orb2995084]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 25.24 KDa. Observed: 38 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human AZU1 Protein, N-His [orb2968977]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
26.69 kDa
1 mg, 50 μg, 100 μgRecombinant Human AZU1/CAP37/HBP Protein, C-His [orb2968978]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
27.85 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide








