You have no items in your shopping cart.
Recombinant Human Delta-like protein 3 (DLL3), partial (Active)
SKU: orb1785019
Featured
Active
Description
Research Area
Stem Cell & Developmental Biology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/mL can bind Anti-DLL3 recombinant antibody. The EC50 is 6.211-7.209 ng/mL. |
| Tag | C-terminal mFc-tagged |
| Expression Region | 429-492aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 36.0 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Delta-like protein 3; Drosophila Delta homolog 3 (Delta3)
Similar Products
−Recombinant Human Delta-like protein 3 (DLL3), partial (Active) [orb1785016]
Greater than 95% as determined by SDS-PAGE.
11.7 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human Delta-like protein 3 (DLL3), partial (Active) [orb1785017]
Greater than 95% as determined by SDS-PAGE.
39.7 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human Delta-like protein 3 (DLL3), partial (Active) [orb1095880]
Greater than 71.6% as determined by SDS-PAGE.
51.5 kDa
Mammalian cell
100 μg, 20 μg, 1 mgRecombinant Human Delta-like protein 3 (DLL3), partial (Active) [orb1785018]
Greater than 95% as determined by SDS-PAGE.
8.1 kDa
Mammalian cell
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide











