You have no items in your shopping cart.
Recombinant Human Interleukin-15 (IL15) (Active)
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is ≤0.5ng/ml. |
| Tag | Tag free |
| Molecular Weight | 12.7 kDa |
| Expression Region | 49-162aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | ≤10 EU/mg by the LAL method |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RecombinantIL-15,His,Human [orb1494833]
> 95% as analyzed by SDS-PAGE.
13.6 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
10 μg, 50 μg, 1 mgRecombinant human IL-15 protein (Active, HEK293) [orb1817193]
>95% as determined by SDS-PAGE
14-15 kDa
10 μg, 50 μgRecombinant human IL-15(hFc Tag) protein (Active, CHO) [orb3124192]
≥ 95% as determined by SDS-PAGE.
38.7 kDa
500 μg, 50 μg, 10 μgRecombinant human IL-15 protein (Active, CHO) [orb3124193]
≥ 95% as determined by SDS-PAGE.
12.7 kDa
500 μg, 50 μg, 10 μgRecombinant Human Interleukin-15 protein(IL15) (Active) [orb1650669]
>97% as determined by SDS-PAGE and HPLC.
12.9 kDa
100 μg, 500 μg, 1 mg, 10 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Interleukin-15 (IL15) (Active) (orb2657898)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review