You have no items in your shopping cart.
Recombinant Human Interleukin-1 alpha(IL1A)
SKU: orb2986464
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 19.4 kDa |
| Expression Region | 113-271aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
| Purity | Greater than 95% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-1 alpha;Hematopoietin-1
Similar Products
−- Item 1 of 1
Recombinant Human Interleukin-1 alpha (IL1A), Biotinylated [orb1096214]
Greater than 85% as determined by SDS-PAGE.
65.8 kDa
E.coli
20 μg, 100 μg, 1 mg Recombinant Human IL1A/IL1F1 Protein, C-His [orb2969640]
>90% as determined by SDS-PAGE.
19.2 kDa
1 mg, 100 μg, 50 μgRecombinant Human IL1A/IL1F1 Protein, C-His [orb2969639]
>90% as determined by SDS-PAGE.
21.28 kDa
1 mg, 100 μg, 50 μgRecombinant Human IL1A/IL1F1 Protein, C-His [orb2836792]
>90% as determined by SDS-PAGE.
21.28 kDa
20 μg, 50 μg, 100 μgRecombinant Human IL1A/IL1F1 Protein, C-His [orb2836793]
>90% as determined by SDS-PAGE.
19.2 kDa
20 μg, 50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Interleukin-1 alpha(IL1A) (orb2986464)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days