You have no items in your shopping cart.
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia coli. |
|---|---|
| Biological Activity | Fully biologically active when compared to the standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 5×105 units/mg. |
| Purification | >95% by SDS-PAGE and HPLC analyses. |
| Endotoxins | Less than 1EU/mg of rHuIL-1α as determined by LAL method. |
| MW | Approximately 26.0 kDa, a single non-glycosylated polypeptide chain containing 227 amino acids. |
| Purity | >95% by SDS-PAGE and HPLC analyses. |
| Protein Sequence | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR |
Storage & Handling
−| Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
| Buffer/Preservatives | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Human Oncostatin-M(209a.a.) (rHuOSM 209a.a.) [orb1495025]
>97% by SDS-PAGE and HPLC analyses.
Approximately 23.9 kDa, a single non-glycosylated polypeptide chain containing 209 amino acids.
Escherichia coli.
1 mg, 2 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Oncostatin-M (rHuOSM) (orb1495026)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review