You have no items in your shopping cart.
Recombinant IL-9 (Interleukin-9), Mouse, Animal-Free
SKU: orb1178932
Description
Images & Validation
−
| Tested Applications | Cell Culture, ELISA |
|---|
Key Properties
−| Source | Escherichia coli |
|---|---|
| Expression System | Escherichia coli |
| Biological Origin | Mouse |
| Biological Activity | Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 106 IU/mg. |
| Reactivity | Mouse |
| Tag | His-tag at the N-terminus |
| Protein Sequence | QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP with polyhistidine tag at the N-terminus. |
| Purity | >98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Endotoxins | <0.1 EU per 1 μg of the protein by the LAL method. |
Storage & Handling
−| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−p40 cytokine, T-cell growth factor p40
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Recombinant IL-9 (Interleukin-9), Mouse, Animal-Free (orb1178932)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days