You have no items in your shopping cart.
Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein&Membrane protein (E&M), partial
SKU: orb1096682
Featured
Description
Research Area
Respiratory Research; Cell Biology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 1-42aa |
| Protein Length | Partial |
| MW | 17.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
