You have no items in your shopping cart.
Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial
SKU: orb1096685
Featured
Description
Research Area
Respiratory Research
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Severe acute respiratory syndrome coronavirus (SARS-CoV) |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 306-527aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 27.2 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered 20mM Tris-HCl,400mM NaCl,6% Trehalose,pH 7.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(S glycoprotein)(E2)(Peplomer protein)
Similar Products
−Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S), partial [orb1674361]
Greater than 85% as determined by SDS-PAGE.
133.9 kDa
Yeast
1 mg, 100 μg, 20 μgRecombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S), partial, Biotinylated [orb1785312]
Greater than 90% as determined by SDS-PAGE.
31.7 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (L452R,T478K), partial [orb2659280]
Greater than 85% as determined by SDS-PAGE.
31.8 kDa
E.coli
100 μg, 1 mgRecombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (I332V,G339H,K356T,S371L,S373P,S375F,R403K,K417N,N440K,V445H,G446S,N450D,L452M,N460K,S477N,T478K,N481K,△483,E484K,F486P,G496S,Q498R,N501Y,Y505H), partial [orb2659284]
Greater than 90% as determined by SDS-PAGE.
25.2 kDa
E.coli
1 mg, 100 μgRecombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (E484K,N501Y), partial [orb2985975]
Greater than 95% as determined by SDS-PAGE.
27.9 kDa
Mammalian cell
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide





