You have no items in your shopping cart.
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | CHO |
|---|---|
| Biological Activity | The EC50 value of rat CINC‑2α/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/rCXCR2 cells (human G15 and ratCXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/ml. |
| Purification | > 98% as analyzed by SDS-PAGE. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| MW | 7.6 kDa, observed by reducing SDS-PAGE. |
| Purity | > 98% as analyzed by SDS-PAGE. |
| Protein Sequence | RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS |
Storage & Handling
−| Storage | Lyophilized recombinant Rat CINC-2α/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat CINC-2α/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Growth Regulated Protein/Melanoma Growth Stimulatory Activity (MGSA γ),CXCL3, GRO gamma, CINC‑2, DCIP‑1, GRO3

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide