RecombinantGRO-γ/CXCL3,Human(CHO-expressed)

SKU: orb1494731

Description

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as GRO3 oncogene (GRO3), GRO protein gamma (GROg) and macrophage inflammatory protein-2-beta (MIP2b). CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of the cerebellum, during morphogenesis.Recombinant humanGRO-gamma/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhGRO-gamma/CXCL3 has a molecular mass of 9kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Images & Validation

−

Application Notes	Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

−

Source	CHO
Biological Activity	The EC50 value of human GRO-gamma/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR2 cells (human Ga15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/ml.
Molecular Weight	9 kDa, observed by reducing SDS-PAGE.
Protein Sequence	ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQ KIIEKILNKGSTN
Purification	> 98% as analyzed by SDS-PAGE.
Purity	> 98% as analyzed by SDS-PAGE.
Endotoxins	< 0.2 EU/μg, determined by LAL method.

Storage & Handling

−

Storage	Lyophilized recombinant Human GRO-gamma/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human GRO-gamma/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/Appearance	Lyophilized after extensive dialysis against PBS.
Buffer/Preservatives	Lyophilized after extensive dialysis against PBS.
Disclaimer	For research use only

Alternative Names

−

GRO-gamma; CXCL3

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols