RecombinantMIP-3α/CCL20,Rat

SKU: orb1494630

Description

Macrophage Inflammatory Protein-3 (MIP-3α), also known as chemokine (C-C motif) ligand 20 (CCL20) or liver activation regulated chemokine (LARC), is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. MIP-3αis implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells toward the epithelial cells surrounding these tissues. MIP-3αis expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor.Recombinant rat MIP-3 α/CCL20 produced in HEK293 cells is a polypeptide chain containing 71 amino acids. A fully biologically active molecule, rrMIP-3 α/CCL20 has a molecular mass of 8.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Images & Validation

−

Application Notes	Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

−

Source	HEK 293
Biological Activity	The EC50 value of rat MIP-3 α/CCL20 on Caˆ2+ mobilization assay in CHO-K1/ G15/rCCR6 cells (human G15 and rat CCR6 stably expressed in CHO-K1 cells) is less than 0.6 μg/ml.
Molecular Weight	8.2 kDa, observed by reducing SDS-PAGE.
Protein Sequence	ASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRIL HLLSLRTKKM
Purification	> 98% as analyzed by SDS-PAGE.
Purity	> 98% as analyzed by SDS-PAGE.
Endotoxins	< 0.2 EU/μg, determined by LAL method.

Storage & Handling

−

Storage	Lyophilized recombinant Rat MIP-3 α/CCL20 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat MIP-3 α/CCL20 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/Appearance	Lyophilized after extensive dialysis against PBS.
Buffer/Preservatives	Lyophilized after extensive dialysis against PBS.
Disclaimer	For research use only

Alternative Names

−

MIP3α, MIP-3 alpha, CCL20

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols