Cart summary

You have no items in your shopping cart.

RELA Rabbit Polyclonal Antibody

SKU: orb573616

Description

Rabbit polyclonal antibody to NFkB p65

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RELA
TargetRELA
Protein SequenceSynthetic peptide located within the following region: VTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Molecular Weight60kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

p65, CMCU, NFKB3

Similar Products

  • NFKB p65 Rabbit Polyclonal Antibody [orb11118]

    FC,  ICC

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • NFKB p65 Rabbit Polyclonal Antibody [orb312399]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-NFKB p65 (Ser468) Rabbit Polyclonal Antibody [orb6503]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Phospho-NFKB p65 (Ser536) Rabbit Polyclonal Antibody [orb6504]

    IF,  IHC-Fr,  IHC-P,  WB

    Human, Monkey, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • RELA Rabbit Polyclonal Antibody [orb573634]

    IHC,  WB

    Bovine, Canine, Porcine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

RELA Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

RELA Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

RELA Rabbit Polyclonal Antibody

Lanes: Lane 1: 50 ug HCT116 cell lysate, Lane 2: 50 ug HT-29 cell lysate, Lane 3: 50 ug T47D cell lysate, Lane 4: 50 ug HEK-293T cell lysate, Lane 5: 50 ug MCF7 cell lysate, Lane 6: 50 ug MDA-MB-231 cell lysate, Primary Antibody dilution: 2 ug/ml, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: Gene Name: RELA.

RELA Rabbit Polyclonal Antibody

RELA antibody - middle region (orb573616) validated by WB using HCT116/Ht-29/T47D/HEK-293T/MCF/MDA-MB-231 cell lines at 2 ug/ml.

RELA Rabbit Polyclonal Antibody

WB Suggested Anti-RELA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_068810

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

RELA Rabbit Polyclonal Antibody (orb573616)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry