RHOT1 Rabbit Polyclonal Antibody

SKU: orb579297

Description

Rabbit polyclonal antibody to RHOT1

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 10

Tested Applications	IHC-P, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human RHOT1
Target	RHOT1
Protein Sequence	Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
Molecular Weight	71 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

ARHT1, MIRO1, MIRO-1

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. There are several isoforms of RHOT1 that contain this N-terminal peptide sequence. Most isoforms are predicted to range from 66 kDa to 80 kDa.

Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

mouse brain and human neuroblastoma

Rabbit Anti-RHOT1 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

RHOT1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579297 with 1:200 dilution. Western blot was performed using orb579297 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: RHOT1 IP with orb579297 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-RHOT1 antibody Titration: 1 ug/ml, Sample Type: Human A549.

Quick Database Links

Gene Symbol

RHOT1

UniProt

Q8IXI2

RefSeq (Protein):NP_060777

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_060777

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC-P

Immunohistochemistry Paraffin

View Protocol

Find More Protocols