Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RHOT1 Rabbit Polyclonal Antibody

SKU: orb579297

Description

Rabbit polyclonal antibody to RHOT1

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RHOT1
TargetRHOT1
Protein SequenceSynthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
Molecular Weight71 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ARHT1, MIRO1, MIRO-1

Similar Products

  • MIRO1/RHOT1 Rabbit Polyclonal Antibody [orb865456]

    ELISA,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • RHOT1 Rabbit Polyclonal Antibody [orb385441]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • RHOT1 Rabbit Polyclonal Antibody [orb579298]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • RHOT1 Rabbit Polyclonal Antibody [orb579299]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • RHOT1 Antibody (N-term) [orb165560]

    WB

    Mouse, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

RHOT1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. There are several isoforms of RHOT1 that contain this N-terminal peptide sequence. Most isoforms are predicted to range from 66 kDa to 80 kDa.

RHOT1 Rabbit Polyclonal Antibody

Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

RHOT1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

RHOT1 Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.

RHOT1 Rabbit Polyclonal Antibody

Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

RHOT1 Rabbit Polyclonal Antibody

mouse brain and human neuroblastoma

RHOT1 Rabbit Polyclonal Antibody

Rabbit Anti-RHOT1 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

RHOT1 Rabbit Polyclonal Antibody

RHOT1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579297 with 1:200 dilution. Western blot was performed using orb579297 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: RHOT1 IP with orb579297 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

RHOT1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

RHOT1 Rabbit Polyclonal Antibody

WB Suggested Anti-RHOT1 antibody Titration: 1 ug/ml, Sample Type: Human A549.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_060777

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

RHOT1 Rabbit Polyclonal Antibody (orb579297)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry