Cart summary

You have no items in your shopping cart.

RORC Rabbit Polyclonal Antibody

SKU: orb330428

Description

Rabbit polyclonal antibody to RORC

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RORC
TargetRORC
Protein SequenceSynthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
Molecular Weight58 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MGC129539 antibody, anti NR1F3 antibody, anti RORG antibody, anti RZRG antibody, anti TOR antibody, anti RZR-GAMMA antibody

Similar Products

  • RORC Rabbit Polyclonal Antibody [orb6888]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • RORγ rabbit pAb Antibody [orb766265]

    IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • RORC Rabbit Polyclonal Antibody [orb329708]

    WB

    Bovine, Equine, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • RORC Rabbit Polyclonal Antibody [orb101495]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Porcine

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • RORC Rabbit Polyclonal Antibody [orb331020]

    IHC-P,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

RORC Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

RORC Rabbit Polyclonal Antibody

Anti-ROR Gamma antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

RORC Rabbit Polyclonal Antibody

Anti-ROR Gamma antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

RORC Rabbit Polyclonal Antibody

Sample Tissue: Human Lung Tumor, Antibody Dilution: 3 ug/mL.

RORC Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

RORC Rabbit Polyclonal Antibody

Positive control (+): Human lung (LU), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/mL.

RORC Rabbit Polyclonal Antibody

WB Suggested Anti-RORC Antibody Titration: 1 ug/mL, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

RORC Rabbit Polyclonal Antibody (orb330428)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry