Cart summary

You have no items in your shopping cart.

RPS6KB1 Rabbit Polyclonal Antibody

SKU: orb583212

Description

Rabbit polyclonal antibody to RPS6KB1

Research Area

Apoptotic, Cancer, Epigenetics, Neuroscience, Signaling Pathways

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RPS6KB1
TargetRPS6KB1
Protein SequenceSynthetic peptide located within the following region: MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL
Molecular Weight59kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

S6K, PS6K, S6K1, STK14A, p70-S6K, p70 S6KA, p70-alpha, S6K-beta-1, p70(S6K)-alpha

Similar Products

  • Phospho-RPS6KB1 (Ser417) Rabbit Polyclonal Antibody [orb6610]

    ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • p70 S6 kinase α Polyclonal Antibody [orb1412619]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • p70 S6 kinase α (phospho Thr444) rabbit pAb Antibody [orb769964]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • p70 S6 kinase α (phospho Ser371) rabbit pAb Antibody [orb769965]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • p70 S6 kinase α (phospho Thr229) rabbit pAb Antibody [orb764265]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Porcine, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

RPS6KB1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

RPS6KB1 Rabbit Polyclonal Antibody

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

RPS6KB1 Rabbit Polyclonal Antibody

Rabbit Anti-RPS6KB1 Antibody, Catalog Number: orb583212, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

RPS6KB1 Rabbit Polyclonal Antibody

WB Suggested Anti-RPS6KB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003152

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

RPS6KB1 Rabbit Polyclonal Antibody (orb583212)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry