Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SIAH1 Rabbit Polyclonal Antibody

SKU: orb329760

Description

Rabbit polyclonal antibody to SIAH1

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SIAH1
TargetSIAH1
Protein SequenceSynthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA
Molecular Weight35kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti SIAH1A antibody

Similar Products

  • SIAH1 Rabbit Polyclonal Antibody [orb576575]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SIAH1/2 Rabbit Polyclonal Antibody [orb224178]

    IF,  IHC,  WB

    Gallus, Human, Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • SIAH1 Rabbit Polyclonal Antibody [orb340838]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • SIAH1 Rabbit Polyclonal Antibody [orb6951]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SIAH1 Rabbit Polyclonal Antibody [orb631179]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SIAH1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

SIAH1 Rabbit Polyclonal Antibody

Rabbit Anti-SIAH1 antibody, Catalog Number: orb329760, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

SIAH1 Rabbit Polyclonal Antibody

Application: Western blotting Species+tissue/cell type: Human embryonic kidney 293T How many ug’s of tissue/cell lysate run on the gel: 1: 50 ug human HEK-293T cell lysatePrimary antibody Dilution: 1:1000, Secondary antibody: Anti-rabbit-IgG Secondary antibody Dilution: 1:5000.

SIAH1 Rabbit Polyclonal Antibody

WB Suggested Anti-SIAH1 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SIAH1 Rabbit Polyclonal Antibody (orb329760)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry