Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SLC9A3 Rabbit Polyclonal Antibody

SKU: orb330345

Description

Rabbit polyclonal antibody to SLC9A3

Research Area

Cell Biology, Pharmacology & Drug Discovery

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Mouse, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC9A3
TargetSLC9A3
Protein SequenceSynthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
Molecular Weight93kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MGC126718 antibody, anti MGC126720 antibody, anti NHE3 antibody

Similar Products

  • EBP50/NHERF-1/SLC9A3R1/NHERF Rabbit Polyclonal Antibody [orb546330]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • NHE3 Antibody (APC) [orb152665]

    ICC,  IF,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    APC

    100 μg
  • NHE3 Antibody (Biotin) [orb152666]

    ICC,  IF,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μg
  • NHE3 Antibody (FITC) [orb152667]

    ICC,  IF,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μg
  • NHE3 Antibody (HRP) [orb152668]

    ICC,  IF,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SLC9A3 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. A shorter form of this protein also contains the peptide sequence at 91 kDa, and the protein may be phosphorylated and/or glycosylated.

SLC9A3 Rabbit Polyclonal Antibody

Sample Tissue: Human RPMI-8226, Antibody Dilution: 1.0 ug/mL.

SLC9A3 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 3 ug/mL.

SLC9A3 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC9A3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004165

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SLC9A3 Rabbit Polyclonal Antibody (orb330345)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry