Cart summary

You have no items in your shopping cart.

STK3 Rabbit Polyclonal Antibody

SKU: orb580491

Description

Rabbit polyclonal antibody to STK3

Research Area

Cell Biology, Immunology & Inflammation, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STK3
TargetSTK3
Protein SequenceSynthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG
Molecular Weight56kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

KRS1, MST2

Similar Products

  • Phospho-MST4 + MST3 + STK25 (Thr178 + Thr190 + Thr174) Rabbit Polyclonal Antibody [orb185140]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • STK3 Rabbit Polyclonal Antibody [orb580492]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Krs-1/2 (phospho Thr183) rabbit pAb Antibody [orb770181]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • MST-3 rabbit pAb Antibody [orb765736]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Phospho-MST1 (Thr183) Rabbit Polyclonal Antibody [orb101054]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Gallus, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

STK3 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

STK3 Rabbit Polyclonal Antibody

Lanes: Lane 1: 30 ug of HeLa cell lysate, Lane 2: 30 ug of 293T cell lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: STK3.

STK3 Rabbit Polyclonal Antibody

Lanes: Lane 1: 100 ug untransfected COS-7 lysate, Lane 2: 100 ug mock transfected Cos-7 lysate, Lane 3: 100 ug STK3 transfected Cos-7 lysate, Lane 4: 50 ug STK3 transfected Cos-7 lysate, Lane 5: 25 ug STK3 transfected Cos-7 lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: STK3.

STK3 Rabbit Polyclonal Antibody

Lanes: Lane 1: 100 ug untransfected RPE-1 lysate, Lane 2: 100 ug untransfected RPE-1 lysate, Lane 3: 100 ug STK3 induced RPE-1 lysate, Lane 4: 100 ug STK3 induced RPE-1 lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: STK3.

STK3 Rabbit Polyclonal Antibody

WB Suggested Anti-STK3 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006272

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

STK3 Rabbit Polyclonal Antibody (orb580491)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry