Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TGFB1 Rabbit Polyclonal Antibody

SKU: orb576457

Description

Rabbit polyclonal antibody to TGF beta 1

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Neuroscience, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIF, IHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Porcine, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse TGFB1
TargetTGFB1
Protein SequenceSynthetic peptide located within the following region: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS
Molecular Weight43kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-beta1

Similar Products

  • TGF beta 1 Rabbit Polyclonal Antibody [orb11468]

    ELISA,  ICC,  IF,  IHC-P,  WB

    Rabbit

    Polyclonal

    Unconjugated

    15 μg, 100 μg, 200 μg
  • TGF beta 1 Rabbit Polyclonal Antibody [orb7087]

    ELISA,  WB

    Bovine, Canine, Guinea pig, Porcine, Rabbit, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TGF Beta 1+2+3 Rabbit Polyclonal Antibody [orb7086]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Guinea pig, Porcine, Sheep

    Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TGFβ1 Polyclonal Antibody [orb1411972]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • TGFB1 Antibody [orb676164]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

TGFB1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

TGFB1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

TGFB1 Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

TGFB1 Rabbit Polyclonal Antibody

Human Spleen

TGFB1 Rabbit Polyclonal Antibody

Immunofluorescent TGFB1 detection in mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). Working dilutions: 5-10 ug/ml.

TGFB1 Rabbit Polyclonal Antibody

TGFB1 in human prostate cancer tissue was detected using HRP/AEC red color stain. Working dilutions: 5-10 ug/ml.

TGFB1 Rabbit Polyclonal Antibody

WB Suggested Anti-TGFB1 Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 dilution. SP2/0 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_035707

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IF
Immunofluorescence
View Protocol

TGFB1 Rabbit Polyclonal Antibody (orb576457)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry