Tnni3k Rabbit Polyclonal Antibody

SKU: orb580260

Description

Tnni3k Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Tnni3k. It is suitable for WB and is reactive with mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Human, Rabbit, Rat, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Mouse
Predicted Reactivity	Bovine, Canine, Equine, Human, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Target	Tnni3k
Protein Sequence	Synthetic peptide located within the following region: NLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEY
Molecular Weight	92kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Ca, Cark, D830019J24Rik

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

WB Suggested Anti-Tnni3k Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.

Quick Database Links

Gene Symbol

Tnni3k

UniProt

B2RTJ7

RefSeq (Protein):NP_796040

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_796040

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols