Cart summary

You have no items in your shopping cart.

UCHL1 Rabbit Polyclonal Antibody

SKU: orb331031

Description

Rabbit polyclonal antibody to PGP9.5

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1
TargetUCHL1
Protein SequenceSynthetic peptide located within the following region: ELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA
Molecular Weight25kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti-Epididymis luminal protein 117 antibody, anti-HEL 117 antibody, anti-HEL S 53 antibody, anti-NDGOA antibody, anti-Neuron cytoplasmic protein 9.5 antibody, anti-Park 5 antibody, anti-PARK5 antibody, anti-PGP 9.5 antibody, anti-PGP9.5 antibody, anti-PGP95 antibody, anti-Protein gene product 9.5 antibody, anti-Ubiquitin C terminal esterase L1 antibody, anti-Ubiquitin C terminal hydrolase antibody, anti-Ubiquitin C terminal hydrolase L1 antibody, anti-Ubiquitin carboxyl terminal esterase L1 antibody, anti-Ubiquitin thioesterase L1 antibody, anti-Ubiquitin thiolesterase antibody, anti-UCH-L1 antibody, anti-UCHL1 antibody, anti-UCHL 1 antibody

Similar Products

  • PGP9.5 Rabbit Polyclonal Antibody [orb500977]

    IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Guinea pig, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • UCHL1 Antibody (N-term) [orb1931714]

    FC,  IF,  IHC-P,  WB

    Porcine

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • PGP9.5/UCHL1/PGP9 Rabbit Polyclonal Antibody [orb334572]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • UCH-L1 rabbit pAb Antibody [orb766746]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • UCHL1 Rabbit Polyclonal Antibody [orb331010]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UCHL1 Rabbit Polyclonal Antibody
UCHL1 Rabbit Polyclonal Antibody
UCHL1 Rabbit Polyclonal Antibody
UCHL1 Rabbit Polyclonal Antibody
UCHL1 Rabbit Polyclonal Antibody

Sample Type: 1. Rat brain cells (100 ug), 2. Rat Brain cells (100 ug) incubatde with HA-UbVME, Band a: unmodified HA-UbVME, Band b: modified UCHL1, Primary dilution: 1:1000, Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit, Secondary dilution: 1:1000.

UCHL1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

UCHL1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 75000 rat INS cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: UCHL1.

UCHL1 Rabbit Polyclonal Antibody

WB Suggested Anti-UCHL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004172

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

UCHL1 Rabbit Polyclonal Antibody (orb331031)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry