Urocortin II, mouse

SKU: orb2694966

Description

Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow.

Images & Validation

−

Key Properties

−

Target	CRFR
Molecular Weight	4152.98
Protein Sequence	VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2
Purity	≥95%

Storage & Handling

−

Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

CRFR

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols