ZBTB32 Rabbit Polyclonal Antibody

SKU: orb573940

Description

Rabbit polyclonal antibody to ZBTB32

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

−

Item 1 of 4

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB32
Target	ZBTB32
Protein Sequence	Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL
Molecular Weight	33 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Rog, FAXF, FAZF, TZFP, ZNF538

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. ZBTB32 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-ZBTB32 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

ZBTB32

UniProt

Q8WVP2

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols