You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF341 |
| Protein Sequence | Synthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC |
| Molecular Weight | 92kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Yaoyi Li 1, Yingliang Sheng 2, Chao Di 3, Hongjie Yao Base-pair resolution reveals clustered R-loops and DNA damage-susceptible R-loops Base-pair resolution reveals clustered R-loops and DNA damage-susceptible R-loops, Mol Cell ., (2025)
Y Li, Y Sheng, C Di, H Yao Capturing R-loops at base-pair resolution unveils clustered R-loops regulate gene expression in a number-dependent manner bioRxiv, (2025)