You have no items in your shopping cart.
Human CD86 protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CTLA-4-Fc-Avi at 5μg/ml can bind Human B7-2-His, the ED50 of Recombinant Human B7-2-His is 1.19 μg/ml. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 26.69 kDa |
| Expression Region | 24-247aa |
| Protein Length | Extracellular Domain |
| Protein Sequence | APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human B7-2 Protein, mFc-His Tag [orb689395]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 52.4 kDa after removal of the signal peptide.
Mammalian
10 μg, 100 μg, 50 μgRecombinant Human B7-2 Protein (Biotin) [orb2993754]
Biotin
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 28.4 KDa. Observed: 55-80 KDa, reducing conditions
20 μg, 100 μgRecombinant Cynomolgus B7-2 Protein [orb2994271]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 52.5 KDa. Observed: 70-100 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse B7-2 Protein [orb2994404]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 52.2 KDa. Observed: 68-95 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human B7-2 Protein [orb2995097]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 26.69 KDa. Observed: 57-66 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Documents Download
Request a Document
Protocol Information
Human CD86 protein (orb594870)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



