You have no items in your shopping cart.
Human TGFB3 protein
SKU: orb594759
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is 10-80 pg/ml. |
| Tag | Tag-Free |
| Molecular Weight | 12.7 kDa |
| Expression Region | 301-412aa(Y340F) |
| Protein Length | Partial |
| Protein Sequence | ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5. |
| Disclaimer | For research use only |
Alternative Names
−Transforming growth factor beta-3;TGFB3;TGF-beta-3;Latency-associated peptide;LAP
Similar Products
−- Item 1 of 2
- Item 1 of 2
- Item 1 of 1
Human TGFB3 protein [orb358393]
Greater than 90% as determined by SDS-PAGE.
48.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human TGFB3 protein [orb624033]
Greater than 90% as determined by SDS-PAGE.
16.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human TGFB3 Protein, hFc Tag [orb1291013]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 58.2 kDa after removal of the signal peptide.
Mammalian
100 μg, 50 μg, 10 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human TGFB3 protein (orb594759)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks