You have no items in your shopping cart.
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Canis lupus familiaris (Dog) (Canis familiaris) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 102-263aa |
| Protein Length | Partial |
| MW | 22.5 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(IL-33)(Protein DVS27)
Similar Products
−- Item 1 of 1
Mouse IL33 protein (Active) [orb359021]
> 98% as determined by SDS-PAGE and HPLC.
17.5 kDa
E.Coli
10 μg, 100 μg, 500 μg 
Recombinant Human IL-33 Protein [orb2995234]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)
Predicted: 18.1 KDa. Observed: 18 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Rhesus macaque IL-33 Protein [orb2994225]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 20.3 KDa. Observed: 21 KDa, reducing conditions
1 mg, 10 μg, 50 μg, 500 μgRecombinant Mouse IL-33 Protein [orb2994601]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 17.6 KDa. Observed: 17-22 KDa, reducing conditions
500 μg, 1 mg, 10 μg, 50 μg- Item 1 of 1
Human IL33 protein (Active) [orb358987]
> 97% as determined by SDS-PAGE and HPLC.
17.9 kDa
E.Coli
10 μg, 100 μg, 500 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
IL33 Protein (orb1477954)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days