Nucleocapsid (SARS-CoV-2) Antibody

SKU: orb1463333

Description

The nucleocapsid protein is one of the core components of the SARS coronavirus (CoV). This protein forms a closed capsule, inside which the genomic RNA is securely stored, and it is also involved in packaging the RNA into virus particles.

Images & Validation

−

Tested Applications	WB
Dilution range	WB:1:500-1:2,000
Reactivity	Virus
Application Notes	The antibody solution should be gently mixed before use.

Key Properties

−

Antibody Type	Primary Antibody
Host	Goat
Clonality	Polyclonal
Isotype	IgG
Immunogen	Antigen: Affinity purified recombinant fusion protein using the C-terminal of Nucleocapsid (residues 280 to stop) and produced in E. coli. Antigen Sequence: MQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
Target	Nucleocapsid (SARS-CoV-2)
Purification	Epitope affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	PBS, 20% glycerol and 0.05% sodium azide
Concentration	1 mg/ml
Disclaimer	For research use only

Alternative Names

−

SARS Coronavirus-2, SARS-CoV-2 NP, SARS-CoV-2 N protein antibody.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

Nucleocapsid (SARS-CoV-2)

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols