You have no items in your shopping cart.
Recombinant Human Vascular endothelial growth factor A (VEGFA)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 30.8 kDa |
| Expression Region | 27-232aa |
| Protein Length | Full Length of Mature Protein of Isoform 1 |
| Protein Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human VEGF 121 [orb2994925]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 14.2 KDa. Observed: 16 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman VEGF 121 [orb2994931]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 90% as determined by SEC-HPLC.(QC verified)
Predicted: 15.1 KDa. Observed: 16-18 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human Vascular endothelial growth factor A (VEGFA), Biotinylated [orb1881661]
Greater than 95% as determined by SDS-PAGE.
22.7 kDa
Mammalian cell
20 μg, 1 mg, 100 μgVEGFA Antibody [orb1289717]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 50 μl, 100 μl, 200 μlRecombinant human VEGF-165 protein, His (HEK293) [orb1516684]
>95% as determined by SDS-PAGE
24 kDa
100 μg, 500 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Vascular endothelial growth factor A (VEGFA) (orb2659568)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





