SMAD4 Rabbit Polyclonal Antibody

SKU: orb574011

Description

Rabbit polyclonal antibody to SMAD4

Research Area

Epigenetics & Chromatin, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 4

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human SMAD4
Target	SMAD4
Protein Sequence	Synthetic peptide located within the following region: NIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNST
Molecular Weight	60 kDa
Purification	Protein A purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	1.0 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

JIP, DPC4, MADH4, MYHRS

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Type: Human nuclear cell extracts (30 ug), Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit HRP, Secondary dilution: 1:20000.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Peptide is present in 60 kDa, 53 kDa, and 35 kDa isoforms, and the protein may be sumoylated or ubiquitinated.

SMAD4 antibody - middle region (orb574011) validated by WB using U2OS nuclear extracts.

WB Suggested Anti-SMAD4 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

SMAD4

UniProt

Q13485

RefSeq (Protein):NP_005350

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_005350

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols