Thrb Rabbit Polyclonal Antibody

SKU: orb329902

Description

Thrb Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Thrb. It is suitable for ChIP, WB applications. The immunogen is a synthetic peptide directed towards the n terminal region of mouse Thrb. This antibody reacts with Mouse samples and is predicted to react with Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

−

Item 1 of 3

Tested Applications	ChIP, WB
Reactivity	Mouse
Predicted Reactivity	Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the n terminal region of mouse Thrb
Target	Thrb
Protein Sequence	Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY
Molecular Weight	54
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti MGC141269 antibody, anti MGC141270 antibody, anti Nr1a2 antibody, anti T3R[b] antibody, anti T3Rbeta antibody, anti Thrb1 antibody, anti Thrb2 antibody, anti c-erbAbeta antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

Thrb

UniProt

P37242

RefSeq (Protein):NP_033406

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_033406

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

ChIP

Chromatin Immunoprecipitation