Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

UCHL1 Rabbit Polyclonal Antibody

SKU: orb331009

Description

UCHL1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of UCHL1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human UCHL1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human UCHL1
TargetUCHL1
Protein SequenceSynthetic peptide located within the following region: AVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVA
Molecular Weight25kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti-Epididymis luminal protein 117 antibody, anti-HEL 117 antibody, anti-HEL S 53 antibody, anti-NDGOA antibody, anti-Neuron cytoplasmic protein 9.5 antibody, anti-Park 5 antibody, anti-PARK5 antibody, anti-PGP 9.5 antibody, anti-PGP9.5 antibody, anti-PGP95 antibody, anti-Protein gene product 9.5 antibody, anti-Ubiquitin C terminal esterase L1 antibody, anti-Ubiquitin C terminal hydrolase antibody, anti-Ubiquitin C terminal hydrolase L1 antibody, anti-Ubiquitin carboxyl terminal esterase L1 antibody, anti-Ubiquitin thioesterase L1 antibody, anti-Ubiquitin thiolesterase antibody, anti-UCH-L1 antibody, anti-UCHL1 antibody, anti-UCHL 1 antibody

Similar Products

  • PGP9.5 Rabbit Polyclonal Antibody [orb6713]

    ELISA,  ICC,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • PGP9.5 Rabbit Polyclonal Antibody [orb500977]

    IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Guinea pig, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • UCHL1 Rabbit Polyclonal Antibody [orb331031]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • UCHL1 Antibody (C-term) [orb1931713]

    FC,  IF,  IHC-P,  WB

    Equine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • PGP9.5/UCHL1/PGP9 Rabbit Polyclonal Antibody [orb334572]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004172

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry