Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

XRCC5 Rabbit Polyclonal Antibody

SKU: orb574940

Description

Rabbit polyclonal antibody to XRCC5

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human XRCC5
TargetXRCC5
Protein SequenceSynthetic peptide located within the following region: GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM
Molecular Weight83kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

KU80, KUB2, Ku86, NFIV, KARP1, KARP-1

Similar Products

  • Ku-80 rabbit pAb Antibody [orb765558]

    ELISA,  IF,  IHC,  WB

    Human, Monkey

    Polyclonal

    Unconjugated

    100 μl
  • Ku80/XRCC5 Rabbit Polyclonal Antibody [orb259641]

    FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Ku-80 (phospho Thr714) rabbit pAb Antibody [orb770395]

    ELISA,  IF,  IHC,  WB

    Human, Monkey

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • XRCC6/XRCC5 Antibody [orb685591]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Ku80 Rabbit Polyclonal Antibody [orb338834]

    IF,  IHC,  WB

    Human, Monkey

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

XRCC5 Rabbit Polyclonal Antibody

Human Pancreas

XRCC5 Rabbit Polyclonal Antibody

Lanes: 1. 30 ug MiaPaca-2 cell lysate, 2. 30 ug Panc-1 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody dilution: 1:4000, Gene Name: XRCC5.

XRCC5 Rabbit Polyclonal Antibody

Sample Type: Human lung adenocarcinoma cell line A549, Primary Antibody dilution: 1:100, Secondary Antibody: Goat anti-rabbit AlexaFluor 488, Secondary Antibody dilution: 1:400, Color/Signal Descriptions: XRCC5: Green DAPI:Blue, Gene Name: XRCC5.

XRCC5 Rabbit Polyclonal Antibody

WB Suggested Anti-XRCC5 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate, XRCC5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_066964

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

XRCC5 Rabbit Polyclonal Antibody (orb574940)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry