You have no items in your shopping cart.
Human IL 1 beta Protein
SKU: orb168624
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | HEK |
|---|---|
| Biological Activity | The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml. |
| Protein Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Purity | Greater than 95% as obsereved by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The IL-1 beta was lyophilized from 1mg/ml in 1xPBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Similar Products
−- Item 1 of 1
Human Interleukin 18 Receptor Accessory Protein (IL18RAP) ELISA Kit [orb777337]
Human
0.16-10 ng/mL
0.053 ng/mL
96 T, 48 T - Item 1 of 1
- Item 1 of 2
- Item 1 of 1
Human IL1B protein (Active) [orb358966]
> 97% as determined by SDS-PAGE and HPLC.
17.3 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 4
Recombinant Human IL1B Protein, hFc Tag [orb1173751]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.5 kDa after removal of the signal peptide.The apparent molecular mass of IL1B-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL 1 beta Protein (orb168624)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days