ORF7a (SARS-CoV-2) Antibody

SKU: orb1463329

Description

ORF7a is a SARS-CoV accessory protein that is composed of a type I transmembrane protein that localizes primarily to the Golgi apparatus and also be found on the cell surface. This protein has been implicated on several mechanisms such as suppressing both transgene and virus-induced gene silencing by reducing the levels of small interfering RNA (siRNA), attachment and modulation of leukocytes by biding to host ITGAL and playing a role as antagonist of host tetherin (BST2) by disrupting its antiviral effect.

Images & Validation

−

Tested Applications	WB
Dilution range	WB:1:500-1:2,000
Reactivity	Virus
Application Notes	The antibody solution should be gently mixed before use.

Key Properties

−

Antibody Type	Primary Antibody
Host	Goat
Clonality	Polyclonal
Isotype	IgG
Immunogen	Antigen: Affinity purified recombinant fusion protein ORF7a (residues 18 to 95) produced in E. coli.. Antigen Sequence: MYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQE
Target	ORF7a (SARS-CoV-2)
Purification	Epitope affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	PBS, 20% glycerol and 0.05% sodium azide
Concentration	1 mg/ml
Disclaimer	For research use only

Alternative Names

−

ORF7a SARS Coronavirus-2 antibody.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

ORF7a (SARS-CoV-2)

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols